| Brand: | Abnova |
| Reference: | H00006590-M01 |
| Product name: | SLPI monoclonal antibody (M01), clone 3C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLPI. |
| Clone: | 3C6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6590 |
| Gene name: | SLPI |
| Gene alias: | ALK1|ALP|BLPI|HUSI|HUSI-I|MPI|WAP4|WFDC4 |
| Gene description: | secretory leukocyte peptidase inhibitor |
| Genbank accession: | NM_003064 |
| Immunogen: | SLPI (NP_003055, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA |
| Protein accession: | NP_003055 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLPI is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |