No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006586-M04 |
Product name: | SLIT3 monoclonal antibody (M04), clone 3C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLIT3. |
Clone: | 3C5 |
Isotype: | IgG2a Kappa |
Gene id: | 6586 |
Gene name: | SLIT3 |
Gene alias: | FLJ10764|MEGF5|SLIL2|SLIT1|Slit-3|slit2 |
Gene description: | slit homolog 3 (Drosophila) |
Genbank accession: | NM_003062 |
Immunogen: | SLIT3 (NP_003053, 1371 a.a. ~ 1470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA |
Protein accession: | NP_003053 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged SLIT3 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |