View larger

SLIT3 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of SLIT3 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00006586-A01
Product name:	SLIT3 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant SLIT3.
Gene id:	6586
Gene name:	SLIT3
Gene alias:	FLJ10764\|MEGF5\|SLIL2\|SLIT1\|Slit-3\|slit2
Gene description:	slit homolog 3 (Drosophila)
Genbank accession:	NM_003062
Immunogen:	SLIT3 (NP_003053, 1371 a.a. ~ 1470 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	PCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA
Protein accession:	NP_003053
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.11 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Type 2 Diabetes Biomarkers and Uses Thereof.Paramithiotis E, Prentki M, Rabasa-lhoret R, Croteau P, Lanoix J, Madiraju MSR, Joly E. United States Patent Application. 2015 Nov. 20150330997A1