| Brand: | Abnova |
| Reference: | H00006583-A01 |
| Product name: | SLC22A4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SLC22A4. |
| Gene id: | 6583 |
| Gene name: | SLC22A4 |
| Gene alias: | MGC34546|MGC40524|OCTN1 |
| Gene description: | solute carrier family 22 (organic cation/ergothioneine transporter), member 4 |
| Genbank accession: | NM_003059 |
| Immunogen: | SLC22A4 (NP_003050, 43 a.a. ~ 141 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK |
| Protein accession: | NP_003050 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SLC22A4 polyclonal antibody (A01), Lot # 061025JCS1. Western Blot analysis of SLC22A4 expression in Daoy. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Expression of OATP1A2 in red blood cells and its potential impact on antimalarial therapy.Hubeny A, Keiser MW, Oswald S, Jedlitschky G, Kroemer HK, Siegmund W, Grube M. Drug Metab Dispos. 2016 Aug 8. [Epub ahead of print] |