| Brand:  | Abnova | 
| Reference:  | H00006575-M04 | 
| Product name:  | SLC20A2 monoclonal antibody (M04), clone 4B1 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant SLC20A2. | 
| Clone:  | 4B1 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 6575 | 
| Gene name:  | SLC20A2 | 
| Gene alias:  | GLVR2|Glvr-2|MLVAR|PIT-2 | 
| Gene description:  | solute carrier family 20 (phosphate transporter), member 2 | 
| Genbank accession:  | NM_006749 | 
| Immunogen:  | SLC20A2 (NP_006740.1, 243 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | TGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGH | 
| Protein accession:  | NP_006740.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.74 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged SLC20A2 is 0.3 ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Localization of type-III sodium-dependent phosphate transporter 2 in the mouse brain.Inden M, Iriyama M, Takagi M, Kaneko M, Hozumi I Brain Res. 2013 Jul 30. pii: S0006-8993(13)01046-9. doi: 10.1016/j.brainres.2013.07.038. |