Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC12A4 monoclonal antibody (M01), clone 1H6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about SLC12A4 monoclonal antibody (M01), clone 1H6
| Brand: | Abnova |
| Reference: | H00006560-M01 |
| Product name: | SLC12A4 monoclonal antibody (M01), clone 1H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC12A4. |
| Clone: | 1H6 |
| Isotype: | IgG1 kappa |
| Gene id: | 6560 |
| Gene name: | SLC12A4 |
| Gene alias: | FLJ40489|KCC1 |
| Gene description: | solute carrier family 12 (potassium/chloride transporters), member 4 |
| Genbank accession: | BC021193 |
| Immunogen: | SLC12A4 (AAH21193, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGTRR |
| Protein accession: | AAH21193 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SLC12A4 expression in transfected 293T cell line by SLC12A4 monoclonal antibody (M01), clone 1H6. Lane 1: SLC12A4 transfected lysate(120.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |