| Brand:  | Abnova | 
| Reference:  | H00006558-M01 | 
| Product name:  | SLC12A2 monoclonal antibody (M01), clone 5H7 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant SLC12A2. | 
| Clone:  | 5H7 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 6558 | 
| Gene name:  | SLC12A2 | 
| Gene alias:  | BSC|BSC2|MGC104233|NKCC1 | 
| Gene description:  | solute carrier family 12 (sodium/potassium/chloride transporters), member 2 | 
| Genbank accession:  | NM_001046 | 
| Immunogen:  | SLC12A2 (NP_001037.1, 903 a.a. ~ 1010 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE | 
| Protein accession:  | NP_001037.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (37.62 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunofluorescence of monoclonal antibody to SLC12A2 on HeLa cell . [antibody concentration 10 ug/ml] | 
| Applications:  | IF,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |