| Brand: | Abnova |
| Reference: | H00006558-M01 |
| Product name: | SLC12A2 monoclonal antibody (M01), clone 5H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC12A2. |
| Clone: | 5H7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6558 |
| Gene name: | SLC12A2 |
| Gene alias: | BSC|BSC2|MGC104233|NKCC1 |
| Gene description: | solute carrier family 12 (sodium/potassium/chloride transporters), member 2 |
| Genbank accession: | NM_001046 |
| Immunogen: | SLC12A2 (NP_001037.1, 903 a.a. ~ 1010 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE |
| Protein accession: | NP_001037.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to SLC12A2 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |