| Brand: | Abnova |
| Reference: | H00006556-M01 |
| Product name: | SLC11A1 monoclonal antibody (M01), clone 2G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC11A1. |
| Clone: | 2G2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6556 |
| Gene name: | SLC11A1 |
| Gene alias: | LSH|NRAMP|NRAMP1 |
| Gene description: | solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1 |
| Genbank accession: | NM_000578 |
| Immunogen: | SLC11A1 (NP_000569.2, 308 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV |
| Protein accession: | NP_000569.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (30.47 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC11A1 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Solute Carrier 11A1 Is Expressed by Innate Lymphocytes and Augments Their Activation.Hedges JF, Kimmel E, Snyder DT, Jerome M, Jutila MA J Immunol. 2013 Apr 15;190(8):4263-73. doi: 10.4049/jimmunol.1200732. Epub 2013 Mar 18. |