| Brand: | Abnova |
| Reference: | H00006538-M10 |
| Product name: | SLC6A11 monoclonal antibody (M10), clone 2C3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC6A11. |
| Clone: | 2C3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6538 |
| Gene name: | SLC6A11 |
| Gene alias: | GAT-3|GAT3 |
| Gene description: | solute carrier family 6 (neurotransmitter transporter, GABA), member 11 |
| Genbank accession: | NM_014229 |
| Immunogen: | SLC6A11 (NP_055044.1, 164 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TELPWATCGHEWNTENCVEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLR |
| Protein accession: | NP_055044.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC6A11 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |