| Brand: | Abnova |
| Reference: | H00006532-M06 |
| Product name: | SLC6A4 monoclonal antibody (M06), clone 2A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC6A4. |
| Clone: | 2A9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6532 |
| Gene name: | SLC6A4 |
| Gene alias: | 5-HTT|5HTT|HTT|OCD1|SERT|hSERT |
| Gene description: | solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 |
| Genbank accession: | NM_001045 |
| Immunogen: | SLC6A4 (NP_001036, 181 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGIS |
| Protein accession: | NP_001036 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC6A4 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |