No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00006532-D01P |
Product name: | SLC6A4 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human SLC6A4 protein. |
Gene id: | 6532 |
Gene name: | SLC6A4 |
Gene alias: | 5-HTT|5HTT|HTT|OCD1|SERT|hSERT |
Gene description: | solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 |
Genbank accession: | NM_001045.2 |
Immunogen: | SLC6A4 (AAH69484.1, 1 a.a. ~ 630 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV |
Protein accession: | AAH69484.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | SLC6A4 MaxPab rabbit polyclonal antibody. Western Blot analysis of SLC6A4 expression in mouse lung. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |