Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC5A3 monoclonal antibody (M02), clone 3A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about SLC5A3 monoclonal antibody (M02), clone 3A6
| Brand: | Abnova |
| Reference: | H00006526-M02 |
| Product name: | SLC5A3 monoclonal antibody (M02), clone 3A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC5A3. |
| Clone: | 3A6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6526 |
| Gene name: | SLC5A3 |
| Gene alias: | SMIT|SMIT2 |
| Gene description: | solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 |
| Genbank accession: | NM_006933 |
| Immunogen: | SLC5A3 (NP_008864, 533 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGE |
| Protein accession: | NP_008864 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC5A3 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Elevated extracellular glucose and uncontrolled type 1 diabetes enhance NFAT5 signaling and disrupt the transverse tubular network in mouse skeletal muscle.Hernandez-Ochoa EO, Robison P, Contreras M, Shen T, Zhao Z, Schneider MF. Exp Biol Med (Maywood). 2012 Sep 1;237(9):1068-83. Epub 2012 Sep 10. |