| Brand: | Abnova |
| Reference: | H00006521-M02 |
| Product name: | SLC4A1 monoclonal antibody (M02), clone 2D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC4A1. |
| Clone: | 2D5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6521 |
| Gene name: | SLC4A1 |
| Gene alias: | AE1|BND3|CD233|DI|EMPB3|EPB3|FR|MGC116750|MGC116753|MGC126619|MGC126623|RTA1A|SW|WD|WD1|WR |
| Gene description: | solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group) |
| Genbank accession: | NM_000342 |
| Immunogen: | SLC4A1 (NP_000333.1, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK |
| Protein accession: | NP_000333.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC4A1 is 0.1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |