SLC3A1 polyclonal antibody (A01) View larger

SLC3A1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC3A1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SLC3A1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006519-A01
Product name: SLC3A1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SLC3A1.
Gene id: 6519
Gene name: SLC3A1
Gene alias: ATR1|CSNU1|D2H|FLJ34681|NBAT|RBAT
Gene description: solute carrier family 3 (cystine, dibasic and neutral amino acid transporters, activator of cystine, dibasic and neutral amino acid transport), member 1
Genbank accession: BC022386
Immunogen: SLC3A1 (AAH22386, 211 a.a. ~ 320 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: FIPNHTSDKHIWFQLSRTRTGKYTDYYIWHDCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEILRFWLTKGVDGFSLDAVKFLL
Protein accession: AAH22386
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006519-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC3A1 polyclonal antibody (A01) now

Add to cart