Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC1A3 monoclonal antibody (M07A), clone 3D1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SLC1A3 monoclonal antibody (M07A), clone 3D1
| Brand: | Abnova |
| Reference: | H00006507-M07A |
| Product name: | SLC1A3 monoclonal antibody (M07A), clone 3D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC1A3. |
| Clone: | 3D1 |
| Isotype: | IgM Kappa |
| Gene id: | 6507 |
| Gene name: | SLC1A3 |
| Gene alias: | EA6|EAAT1|FLJ25094|GLAST|GLAST1 |
| Gene description: | solute carrier family 1 (glial high affinity glutamate transporter), member 3 |
| Genbank accession: | NM_004172 |
| Immunogen: | SLC1A3 (NP_004163.2, 162 a.a. ~ 237 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS |
| Protein accession: | NP_004163.2 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Involvement of Crosstalk between Oct4 and Meis1a in Neural Cell Fate Decision.Yamada T, Urano-Tashiro Y, Tanaka S, Akiyama H, Tashiro F PLoS One. 2013;8(2):e56997. doi: 10.1371/journal.pone.0056997. Epub 2013 Feb 25. |