SLA polyclonal antibody (A01) View larger

SLA polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLA polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SLA polyclonal antibody (A01)

Brand: Abnova
Reference: H00006503-A01
Product name: SLA polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant SLA.
Gene id: 6503
Gene name: SLA
Gene alias: SLA1|SLAP
Gene description: Src-like-adaptor
Genbank accession: BC007042
Immunogen: SLA (AAH07042, 1 a.a. ~ 276 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED
Protein accession: AAH07042
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006503-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (56.47 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLA polyclonal antibody (A01) now

Add to cart