SKP1A (Human) Recombinant Protein (P01) View larger

SKP1A (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SKP1A (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about SKP1A (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00006500-P01
Product name: SKP1A (Human) Recombinant Protein (P01)
Product description: Human SKP1A full-length ORF ( AAH25673, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 6500
Gene name: SKP1
Gene alias: EMC19|MGC34403|OCP-II|OCP2|SKP1A|TCEB1L|p19A
Gene description: S-phase kinase-associated protein 1
Genbank accession: BC025673
Immunogen sequence/protein sequence: MPSIKLQSFDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
Protein accession: AAH25673
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00006500-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Calmodulin protects Aurora B on the midbody to regulate the fidelity of cytokinesis.Mallampalli RK, Glasser JR, Coon TA, Chen BB
Cell Cycle. 2013 Feb 15;12(4):663-73. doi: 10.4161/cc.23586. Epub 2013 Jan 31.

Reviews

Buy SKP1A (Human) Recombinant Protein (P01) now

Add to cart