| Brand: | Abnova |
| Reference: | H00006500-P01 |
| Product name: | SKP1A (Human) Recombinant Protein (P01) |
| Product description: | Human SKP1A full-length ORF ( AAH25673, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 6500 |
| Gene name: | SKP1 |
| Gene alias: | EMC19|MGC34403|OCP-II|OCP2|SKP1A|TCEB1L|p19A |
| Gene description: | S-phase kinase-associated protein 1 |
| Genbank accession: | BC025673 |
| Immunogen sequence/protein sequence: | MPSIKLQSFDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL |
| Protein accession: | AAH25673 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Calmodulin protects Aurora B on the midbody to regulate the fidelity of cytokinesis.Mallampalli RK, Glasser JR, Coon TA, Chen BB Cell Cycle. 2013 Feb 15;12(4):663-73. doi: 10.4161/cc.23586. Epub 2013 Jan 31. |