SKP1A monoclonal antibody (M03), clone 2E6 View larger

SKP1A monoclonal antibody (M03), clone 2E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SKP1A monoclonal antibody (M03), clone 2E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about SKP1A monoclonal antibody (M03), clone 2E6

Brand: Abnova
Reference: H00006500-M03
Product name: SKP1A monoclonal antibody (M03), clone 2E6
Product description: Mouse monoclonal antibody raised against a partial recombinant SKP1A.
Clone: 2E6
Isotype: IgG2a Kappa
Gene id: 6500
Gene name: SKP1
Gene alias: EMC19|MGC34403|OCP-II|OCP2|SKP1A|TCEB1L|p19A
Gene description: S-phase kinase-associated protein 1
Genbank accession: NM_006930
Immunogen: SKP1A (NP_008861, 53 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
Protein accession: NP_008861
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006500-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006500-M03-1-1-1.jpg
Application image note: SKP1A monoclonal antibody (M03), clone 2E6. Western Blot analysis of SKP1A expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SKP1A monoclonal antibody (M03), clone 2E6 now

Add to cart