| Brand: | Abnova |
| Reference: | H00006500-M01 |
| Product name: | SKP1A monoclonal antibody (M01), clone 1H8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SKP1A. |
| Clone: | 1H8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6500 |
| Gene name: | SKP1 |
| Gene alias: | EMC19|MGC34403|OCP-II|OCP2|SKP1A|TCEB1L|p19A |
| Gene description: | S-phase kinase-associated protein 1 |
| Genbank accession: | NM_006930 |
| Immunogen: | SKP1A (NP_008861, 53 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL |
| Protein accession: | NP_008861 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to SKP1A on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |