Brand: | Abnova |
Reference: | H00006500-M01 |
Product name: | SKP1A monoclonal antibody (M01), clone 1H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SKP1A. |
Clone: | 1H8 |
Isotype: | IgG2a Kappa |
Gene id: | 6500 |
Gene name: | SKP1 |
Gene alias: | EMC19|MGC34403|OCP-II|OCP2|SKP1A|TCEB1L|p19A |
Gene description: | S-phase kinase-associated protein 1 |
Genbank accession: | NM_006930 |
Immunogen: | SKP1A (NP_008861, 53 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL |
Protein accession: | NP_008861 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to SKP1A on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |