Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SIM2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about SIM2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00006493-A01 |
| Product name: | SIM2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SIM2. |
| Gene id: | 6493 |
| Gene name: | SIM2 |
| Gene alias: | MGC119447|SIM|bHLHe15 |
| Gene description: | single-minded homolog 2 (Drosophila) |
| Genbank accession: | NM_005069 |
| Immunogen: | SIM2 (NP_005060, 426 a.a. ~ 525 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLSTLPASGECQWHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYE |
| Protein accession: | NP_005060 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SIM2 polyclonal antibody (A01), Lot # O51024JC01 Western Blot analysis of SIM2 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Celastrol regulates multiple nuclear transcription factors belonging to HSP90's clients in a dose- and cell type-dependent way.Zhang D, Xu L, Cao F, Wei T, Yang C, Uzan G, Peng B. Cell Stress Chaperones. 2010 Nov;15(6):939-46. Epub 2010 May 18. |