Brand: | Abnova |
Reference: | H00006493-A01 |
Product name: | SIM2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SIM2. |
Gene id: | 6493 |
Gene name: | SIM2 |
Gene alias: | MGC119447|SIM|bHLHe15 |
Gene description: | single-minded homolog 2 (Drosophila) |
Genbank accession: | NM_005069 |
Immunogen: | SIM2 (NP_005060, 426 a.a. ~ 525 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLSTLPASGECQWHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYE |
Protein accession: | NP_005060 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SIM2 polyclonal antibody (A01), Lot # O51024JC01 Western Blot analysis of SIM2 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Celastrol regulates multiple nuclear transcription factors belonging to HSP90's clients in a dose- and cell type-dependent way.Zhang D, Xu L, Cao F, Wei T, Yang C, Uzan G, Peng B. Cell Stress Chaperones. 2010 Nov;15(6):939-46. Epub 2010 May 18. |