Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ST3GAL4 monoclonal antibody (M01), clone 1F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA |
More info about ST3GAL4 monoclonal antibody (M01), clone 1F4
| Brand: | Abnova |
| Reference: | H00006484-M01 |
| Product name: | ST3GAL4 monoclonal antibody (M01), clone 1F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ST3GAL4. |
| Clone: | 1F4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6484 |
| Gene name: | ST3GAL4 |
| Gene alias: | CGS23|FLJ11867|FLJ46764|NANTA3|SAT3|SIAT4|SIAT4C|ST3GalIV|STZ |
| Gene description: | ST3 beta-galactoside alpha-2,3-sialyltransferase 4 |
| Genbank accession: | NM_006278 |
| Immunogen: | ST3GAL4 (NP_006269, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSL |
| Protein accession: | NP_006269 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ST3GAL4 monoclonal antibody (M01), clone 1F4. Western Blot analysis of ST3GAL4 expression in MCF-7 ( Cat # L046V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |