| Brand: | Abnova |
| Reference: | H00006483-M01 |
| Product name: | ST3GAL2 monoclonal antibody (M01), clone 1E12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ST3GAL2. |
| Clone: | 1E12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6483 |
| Gene name: | ST3GAL2 |
| Gene alias: | Gal-NAc6S|SIAT4B|ST3GALII|ST3GalA.2 |
| Gene description: | ST3 beta-galactoside alpha-2,3-sialyltransferase 2 |
| Genbank accession: | NM_006927 |
| Immunogen: | ST3GAL2 (NP_008858, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEV |
| Protein accession: | NP_008858 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ST3GAL2 monoclonal antibody (M01), clone 1E12 Western Blot analysis of ST3GAL2 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |