| Brand: | Abnova |
| Reference: | H00006477-M02 |
| Product name: | SIAH1 monoclonal antibody (M02), clone 2C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SIAH1. |
| Clone: | 2C5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6477 |
| Gene name: | SIAH1 |
| Gene alias: | FLJ08065|HUMSIAH|Siah-1|Siah-1a|hSIAH1 |
| Gene description: | seven in absentia homolog 1 (Drosophila) |
| Genbank accession: | NM_003031 |
| Immunogen: | SIAH1 (NP_003022, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLP |
| Protein accession: | NP_003022 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SIAH1 monoclonal antibody (M02), clone 2C5. Western Blot analysis of SIAH1 expression in Jurkat(Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |