| Brand: | Abnova |
| Reference: | H00006456-M01 |
| Product name: | SH3GL2 monoclonal antibody (M01), clone 5A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SH3GL2. |
| Clone: | 5A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6456 |
| Gene name: | SH3GL2 |
| Gene alias: | CNSA2|EEN-B1|FLJ20276|FLJ25015|SH3D2A|SH3P4 |
| Gene description: | SH3-domain GRB2-like 2 |
| Genbank accession: | NM_003026 |
| Immunogen: | SH3GL2 (NP_003017, 64 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL |
| Protein accession: | NP_003017 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.45 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SH3GL2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | SH3GL2 is frequently deleted in non-small cell lung cancer and downregulates tumor growth by modulating EGFR signaling.Dasgupta S, Jang JS, Shao C, Mukhopadhyay ND, Sokhi UK, Das SK, Brait M, Talbot C, Yung RC, Begum S, Westra WH, Hoque MO, Ping Y, Yi JE, Lam S, Gazdar AF, Fisher PB, Jen J, Sidransky D. J Mol Med (Berl). 2012 Sep 12. 91(3):381-393. |