| Brand: | Abnova |
| Reference: | H00006455-M02 |
| Product name: | SH3GL1 monoclonal antibody (M02), clone 2B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SH3GL1. |
| Clone: | 2B5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6455 |
| Gene name: | SH3GL1 |
| Gene alias: | CNSA1|EEN|MGC111371|SH3D2B|SH3P8 |
| Gene description: | SH3-domain GRB2-like 1 |
| Genbank accession: | NM_003025 |
| Immunogen: | SH3GL1 (NP_003016, 12 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGE |
| Protein accession: | NP_003016 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SH3GL1 is 3 ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |