Cart 42 Product Products 12 687,59 € (empty)
-
1 x AW-1...259,07 € -
1 x Phospho-AP...259,07 € -
1 x ApoER2...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x TBG...554,11 € -
1 x IGFBP1...379,42 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
265,00 € DAP Shipping
12 952,59 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 42 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 12 687,59 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 12 952,59 €
Data sheet of SCG5 (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about SCG5 (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00006447-Q01 |
| Product name: | SCG5 (Human) Recombinant Protein (Q01) |
| Product description: | Human SCG5 partial ORF ( NP_003011, 59 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 6447 |
| Gene name: | SCG5 |
| Gene alias: | 7B2|P7B2|SGNE1|SgV |
| Gene description: | secretogranin V (7B2 protein) |
| Genbank accession: | NM_003020 |
| Immunogen sequence/protein sequence: | EYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGL |
| Protein accession: | NP_003011 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |