Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SCG5 monoclonal antibody (M02), clone 8G11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about SCG5 monoclonal antibody (M02), clone 8G11
| Brand: | Abnova |
| Reference: | H00006447-M02 |
| Product name: | SCG5 monoclonal antibody (M02), clone 8G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SCG5. |
| Clone: | 8G11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6447 |
| Gene name: | SCG5 |
| Gene alias: | 7B2|P7B2|SGNE1|SgV |
| Gene description: | secretogranin V (7B2 protein) |
| Genbank accession: | NM_003020 |
| Immunogen: | SCG5 (NP_003011, 59 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGL |
| Protein accession: | NP_003011 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SCG5 is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | {alpha}-melanocyte-stimulating Hormone Inhibits TNF-{alpha}-stimulated MUC5AC Expression in Human Nasal Epithelial Cells.Lee SN, Ryu JH, Joo JH, Choi YH, Lee HJ, Kim YJ, Kim KB, Yoon JH. Am J Respir Cell Mol Biol. 2010 Jul 16. [Epub ahead of print] |