| Brand: | Abnova |
| Reference: | H00006443-M02 |
| Product name: | SGCB monoclonal antibody (M02), clone 1C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SGCB. |
| Clone: | 1C10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6443 |
| Gene name: | SGCB |
| Gene alias: | A3b|LGMD2E|SGC |
| Gene description: | sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) |
| Genbank accession: | NM_000232 |
| Immunogen: | SGCB (NP_000223, 87 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | WAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGNNQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVK |
| Protein accession: | NP_000223 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SGCB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |