| Brand: | Abnova |
| Reference: | H00006441-M01 |
| Product name: | SFTPD monoclonal antibody (M01), clone 3E6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SFTPD. |
| Clone: | 3E6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6441 |
| Gene name: | SFTPD |
| Gene alias: | COLEC7|PSP-D|SFTP4|SP-D |
| Gene description: | surfactant protein D |
| Genbank accession: | BC022318 |
| Immunogen: | SFTPD (AAH22318.1, 21 a.a. ~ 375 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF |
| Protein accession: | AAH22318.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (64.79 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SFTPD monoclonal antibody (M01), clone 3E6 Western Blot analysis of SFTPD expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |