| Brand: | Abnova |
| Reference: | H00006439-M01 |
| Product name: | SFTPB monoclonal antibody (M01), clone 1H7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SFTPB. |
| Clone: | 1H7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6439 |
| Gene name: | SFTPB |
| Gene alias: | PSP-B|SFTB3|SFTP3|SMDP1|SP-B |
| Gene description: | surfactant protein B |
| Genbank accession: | NM_000542.2 |
| Immunogen: | SFTPB (NP_000533.2, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL |
| Protein accession: | NP_000533.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (68.5 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SFTPB monoclonal antibody (M01), clone 1H7. Western Blot analysis of SFTPB expression in human lung cancer. |
| Applications: | WB-Ti,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |