| Brand:  | Abnova | 
| Reference:  | H00006439-M01 | 
| Product name:  | SFTPB monoclonal antibody (M01), clone 1H7 | 
| Product description:  | Mouse monoclonal antibody raised against a full-length recombinant SFTPB. | 
| Clone:  | 1H7 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 6439 | 
| Gene name:  | SFTPB | 
| Gene alias:  | PSP-B|SFTB3|SFTP3|SMDP1|SP-B | 
| Gene description:  | surfactant protein B | 
| Genbank accession:  | NM_000542.2 | 
| Immunogen:  | SFTPB (NP_000533.2, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL | 
| Protein accession:  | NP_000533.2 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (68.5 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | SFTPB monoclonal antibody (M01), clone 1H7. Western Blot analysis of SFTPB expression in human lung cancer. | 
| Applications:  | WB-Ti,ELISA,WB-Re,WB-Tr | 
| Shipping condition:  | Dry Ice |