No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Wheat Germ (in vitro) |
Applications | AP,Array,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006428-Q01 |
Product name: | SFRS3 (Human) Recombinant Protein (Q01) |
Product description: | Human SFRS3 partial ORF ( NP_003008, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 6428 |
Gene name: | SFRS3 |
Gene alias: | SRp20 |
Gene description: | splicing factor, arginine/serine-rich 3 |
Genbank accession: | NM_003017 |
Immunogen sequence/protein sequence: | MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEK |
Protein accession: | NP_003008 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![]() |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Antagonistic SR proteins regulate alternative splicing of tumor-related Rac1b downstream of the PI3-kinase and Wnt pathways.Goncalves V, Matos P, Jordan P. Hum Mol Genet. 2009 Oct 1;18(19):3696-707. Epub 2009 Jul 13. |