| Brand: | Abnova |
| Reference: | H00006428-M08 |
| Product name: | SFRS3 monoclonal antibody (M08), clone 2D2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SFRS3. |
| Clone: | 2D2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6428 |
| Gene name: | SFRS3 |
| Gene alias: | SRp20 |
| Gene description: | splicing factor, arginine/serine-rich 3 |
| Genbank accession: | NM_003017 |
| Immunogen: | SFRS3 (NP_003008, 1 a.a. ~ 85 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEK |
| Protein accession: | NP_003008 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to SFRS3 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | LBH589 induces up to 10-fold SMN protein levels by several independent mechanisms and is effective even in cells from SMA patients non-responsive to valproate.Garbes L, Riessland M, Holker I, Heller R, Hauke J, Trankle C, Coras R, Blumcke I, Hahnen E, Wirth B. Hum Mol Genet. 2009 Oct 1;18(19):3645-58. Epub 2009 Jul 7. |