No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006421-A01 |
Product name: | SFPQ polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SFPQ. |
Gene id: | 6421 |
Gene name: | SFPQ |
Gene alias: | POMP100|PSF |
Gene description: | splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated) |
Genbank accession: | NM_005066 |
Immunogen: | SFPQ (NP_005057, 269 a.a. ~ 361 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ |
Protein accession: | NP_005057 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | TRAP150 interacts with the RNA-binding domain of PSF and antagonizes splicing of numerous PSF-target genes in T cells.Christopher A. Yarosh, Iulia Tapescu, Matthew G. Thompson, Jinsong Qiu, Michael J. Mallory, Xiang-Dong Fu and Kristen W. Lynch. Nucleic Acid Research. 2015 |