View larger

SFPQ polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of SFPQ polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00006421-A01
Product name:	SFPQ polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant SFPQ.
Gene id:	6421
Gene name:	SFPQ
Gene alias:	POMP100\|PSF
Gene description:	splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)
Genbank accession:	NM_005066
Immunogen:	SFPQ (NP_005057, 269 a.a. ~ 361 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ
Protein accession:	NP_005057
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.34 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	TRAP150 interacts with the RNA-binding domain of PSF and antagonizes splicing of numerous PSF-target genes in T cells.Christopher A. Yarosh, Iulia Tapescu, Matthew G. Thompson, Jinsong Qiu, Michael J. Mallory, Xiang-Dong Fu and Kristen W. Lynch. Nucleic Acid Research. 2015