SETMAR purified MaxPab mouse polyclonal antibody (B01P) View larger

SETMAR purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SETMAR purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about SETMAR purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00006419-B01P
Product name: SETMAR purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SETMAR protein.
Gene id: 6419
Gene name: SETMAR
Gene alias: METNASE
Gene description: SET domain and mariner transposase fusion gene
Genbank accession: BC011635.2
Immunogen: SETMAR (AAH11635.1, 1 a.a. ~ 352 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLEVSLFSDKQLAPPYSGRQWLASFTSA
Protein accession: AAH11635.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006419-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SETMAR expression in transfected 293T cell line (H00006419-T01) by SETMAR MaxPab polyclonal antibody.

Lane 1: SETMAR transfected lysate(38.72 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SETMAR purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart