| Brand: | Abnova |
| Reference: | H00006418-M01 |
| Product name: | SET monoclonal antibody (M01), clone M1-F5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SET. |
| Clone: | M1-F5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6418 |
| Gene name: | SET |
| Gene alias: | 2PP2A|I2PP2A|IGAAD|IPP2A2|PHAPII|TAF-I|TAF-IBETA |
| Gene description: | SET nuclear oncogene |
| Genbank accession: | BC032749 |
| Immunogen: | SET (AAH32749.1, 1 a.a. ~ 277 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD |
| Protein accession: | AAH32749.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (56.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SET is approximately 3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |