No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006391-M02 |
Product name: | SDHC monoclonal antibody (M02), clone 3G7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant SDHC. |
Clone: | 3G7 |
Isotype: | IgG2a Kappa |
Gene id: | 6391 |
Gene name: | SDHC |
Gene alias: | CYB560|CYBL|PGL3|QPS1|SDH3 |
Gene description: | succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa |
Genbank accession: | BC033626 |
Immunogen: | SDHC (AAH33626, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM |
Protein accession: | AAH33626 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (44.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged SDHC is approximately 30ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Mutations in the heme b-binding residue of SDHC inhibit assembly of respiratory chain complex II in mammalian cells.Lemarie A, Grimm S. Mitochondrion. 2009 Jul;9(4):254-60. Epub 2009 Mar 28. |