| Brand:  | Abnova | 
| Reference:  | H00006388-M01 | 
| Product name:  | SDF2 monoclonal antibody (M01), clone 3G7-1D6 | 
| Product description:  | Mouse monoclonal antibody raised against a full length recombinant SDF2. | 
| Clone:  | 3G7-1D6 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 6388 | 
| Gene name:  | SDF2 | 
| Gene alias:  | - | 
| Gene description:  | stromal cell-derived factor 2 | 
| Genbank accession:  | BC000500 | 
| Immunogen:  | SDF2 (AAH00500.1, 20 a.a. ~ 211 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | SLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL | 
| Protein accession:  | AAH00500.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (46.75 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | SDF2 monoclonal antibody (M01), clone 3G7-1D6 Western Blot analysis of SDF2 expression in WI-38 ( Cat # L016V1 ). | 
| Applications:  | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |