| Brand:  | Abnova | 
| Reference:  | H00006387-M04 | 
| Product name:  | CXCL12 monoclonal antibody (M04), clone 1B2 | 
| Product description:  | Mouse monoclonal antibody raised against a full length recombinant CXCL12. | 
| Clone:  | 1B2 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 6387 | 
| Gene name:  | CXCL12 | 
| Gene alias:  | PBSF|SCYB12|SDF-1a|SDF-1b|SDF1|SDF1A|SDF1B|TLSF-a|TLSF-b|TPAR1 | 
| Gene description:  | chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) | 
| Genbank accession:  | BC039893 | 
| Immunogen:  | CXCL12 (AAH39893.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK | 
| Protein accession:  | AAH39893.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged CXCL12 is approximately 3ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA | 
| Shipping condition:  | Dry Ice |