| Brand: | Abnova |
| Reference: | H00006387-M04 |
| Product name: | CXCL12 monoclonal antibody (M04), clone 1B2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CXCL12. |
| Clone: | 1B2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6387 |
| Gene name: | CXCL12 |
| Gene alias: | PBSF|SCYB12|SDF-1a|SDF-1b|SDF1|SDF1A|SDF1B|TLSF-a|TLSF-b|TPAR1 |
| Gene description: | chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) |
| Genbank accession: | BC039893 |
| Immunogen: | CXCL12 (AAH39893.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
| Protein accession: | AAH39893.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CXCL12 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |