| Reference:  | H00006386-M01 | 
| Product name:  | SDCBP monoclonal antibody (M01), clone 2C12 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant SDCBP. | 
| Clone:  | 2C12 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 6386 | 
| Gene name:  | SDCBP | 
| Gene alias:  | MDA-9|ST1|SYCL|TACIP18 | 
| Gene description:  | syndecan binding protein (syntenin) | 
| Genbank accession:  | NM_005625 | 
| Immunogen:  | SDCBP (NP_005616, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND | 
| Protein accession:  | NP_005616 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Shipping condition:  | Dry Ice |