| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00006386-B01P |
| Product name: | SDCBP purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SDCBP protein. |
| Gene id: | 6386 |
| Gene name: | SDCBP |
| Gene alias: | MDA-9|ST1|SYCL|TACIP18 |
| Gene description: | syndecan binding protein (syntenin) |
| Genbank accession: | NM_001007067 |
| Immunogen: | SDCBP (NP_001007068.1, 1 a.a. ~ 298 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV |
| Protein accession: | NP_001007068.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SDCBP expression in transfected 293T cell line (H00006386-T01) by SDCBP MaxPab polyclonal antibody. Lane 1: SDCBP transfected lysate(32.78 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Differential protein profiling of renal cell carcinoma urinary exosomes.Raimondo F, Morosi L, Corbetta S, Chinello C, Brambilla P, Della Mina P, Villa A, Albo G, Battaglia C, Bosari S, Magni F, Pitto M. Mol Biosyst. 2013 Jun 7;9(6):1220-33. doi: 10.1039/ c3mb25582d. Epub 2013 Mar 19. |