Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00006383-B04P |
Product name: | SDC2 purified MaxPab mouse polyclonal antibody (B04P) |
Product description: | Mouse polyclonal antibody raised against a full-length human SDC2 protein. |
Gene id: | 6383 |
Gene name: | SDC2 |
Gene alias: | HSPG|HSPG1|SYND2 |
Gene description: | syndecan 2 |
Genbank accession: | NM_002998 |
Immunogen: | SDC2 (NP_002989.2, 19 a.a. ~ 201 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA |
Protein accession: | NP_002989.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SDC2 expression in transfected 293T cell line (H00006383-T06) by SDC2 MaxPab polyclonal antibody. Lane 1: SDC2 transfected lysate(20.13 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Syndecan-2 regulation of morphology in breast carcinoma cells is dependent on RhoGTPases.Lim HC, Couchman JR Biochim Biophys Acta. 2014 Jan 18. pii: S0304-4165(14)00026-9. doi: 10.1016/j.bbagen.2014.01.018. |