Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SDC2 purified MaxPab mouse polyclonal antibody (B04P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about SDC2 purified MaxPab mouse polyclonal antibody (B04P)
| Brand: | Abnova |
| Reference: | H00006383-B04P |
| Product name: | SDC2 purified MaxPab mouse polyclonal antibody (B04P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SDC2 protein. |
| Gene id: | 6383 |
| Gene name: | SDC2 |
| Gene alias: | HSPG|HSPG1|SYND2 |
| Gene description: | syndecan 2 |
| Genbank accession: | NM_002998 |
| Immunogen: | SDC2 (NP_002989.2, 19 a.a. ~ 201 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA |
| Protein accession: | NP_002989.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SDC2 expression in transfected 293T cell line (H00006383-T06) by SDC2 MaxPab polyclonal antibody. Lane 1: SDC2 transfected lysate(20.13 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Syndecan-2 regulation of morphology in breast carcinoma cells is dependent on RhoGTPases.Lim HC, Couchman JR Biochim Biophys Acta. 2014 Jan 18. pii: S0304-4165(14)00026-9. doi: 10.1016/j.bbagen.2014.01.018. |