Cart 10 Product Products 3 119,42 € (empty)
No products
To be determined Shipping
3 119,42 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 10 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 119,42 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 119,42 €
Data sheet of XCL1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about XCL1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00006375-A01 |
| Product name: | XCL1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant XCL1. |
| Gene id: | 6375 |
| Gene name: | XCL1 |
| Gene alias: | ATAC|LPTN|LTN|SCM-1|SCM-1a|SCM1|SCYC1 |
| Gene description: | chemokine (C motif) ligand 1 |
| Genbank accession: | NM_002995 |
| Immunogen: | XCL1 (NP_002986, 22 a.a. ~ 114 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
| Protein accession: | NP_002986 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Perivascular expression of CXCL9 and CXCL12 in primary central nervous system lymphoma: T-cell infiltration and positioning of malignant B cells.Venetz D, Ponzoni M, Schiraldi M, Ferreri AJ, Bertoni F, Doglioni C, Uguccioni M. Int J Cancer. 2010 Nov 15;127(10):2300-12. |