No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | ELISA,WB-Re |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CXCL5. |
Clone: | 2A9-G8 |
Isotype: | IgG1 Kappa |
Gene id: | 6374 |
Gene name: | CXCL5 |
Gene alias: | ENA-78|SCYB5 |
Gene description: | chemokine (C-X-C motif) ligand 5 |
Genbank accession: | BC008376 |
Immunogen: | CXCL5 (AAH08376, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN |
Protein accession: | AAH08376 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Size: | 50 ug |
Shipping condition: | Dry Ice |