Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CXCL5 monoclonal antibody (M05), clone 2A9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,ELISA,WB-Re |
More info about CXCL5 monoclonal antibody (M05), clone 2A9
| Brand: | Abnova |
| Reference: | H00006374-M05 |
| Product name: | CXCL5 monoclonal antibody (M05), clone 2A9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CXCL5. |
| Clone: | 2A9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6374 |
| Gene name: | CXCL5 |
| Gene alias: | ENA-78|SCYB5 |
| Gene description: | chemokine (C-X-C motif) ligand 5 |
| Genbank accession: | BC008376 |
| Immunogen: | CXCL5 (AAH08376, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN |
| Protein accession: | AAH08376 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CXCL5 on formalin-fixed paraffin-embedded human smooth muscle. [antibody concentration 0.7 ug/ml] |
| Applications: | IHC-P,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | CXCL5 knockdown expression inhibits human bladder cancer T24 cells proliferation and migration.Zheng J, Zhu X, Zhang J Biochem Biophys Res Commun. 2014 Feb 26. pii: S0006-291X(14)00215-0. doi: 10.1016/j.bbrc.2014.01.172. |