CXCL5 MaxPab mouse polyclonal antibody (B02) View larger

CXCL5 MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CXCL5 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CXCL5 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00006374-B02
Product name: CXCL5 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human CXCL5 protein.
Gene id: 6374
Gene name: CXCL5
Gene alias: ENA-78|SCYB5
Gene description: chemokine (C-X-C motif) ligand 5
Genbank accession: NM_002994
Immunogen: CXCL5 (NP_002985, 1 a.a. ~ 114 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Protein accession: NP_002985
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006374-B02-13-15-1.jpg
Application image note: Western Blot analysis of CXCL5 expression in transfected 293T cell line (H00006374-T02) by CXCL5 MaxPab polyclonal antibody.

Lane 1: CXCL5 transfected lysate(12.54 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CXCL5 MaxPab mouse polyclonal antibody (B02) now

Add to cart