| Brand:  | Abnova | 
| Reference:  | H00006373-M02A | 
| Product name:  | CXCL11 monoclonal antibody (M02A), clone 3C1 | 
| Product description:  | Mouse monoclonal antibody raised against a full-length recombinant CXCL11. | 
| Clone:  | 3C1 | 
| Isotype:  | IgM Kappa | 
| Gene id:  | 6373 | 
| Gene name:  | CXCL11 | 
| Gene alias:  | H174|I-TAC|IP-9|IP9|MGC102770|SCYB11|SCYB9B|b-R1 | 
| Gene description:  | chemokine (C-X-C motif) ligand 11 | 
| Genbank accession:  | BC005292 | 
| Immunogen:  | CXCL11 (AAH05292, 1 a.a. ~ 94 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF | 
| Protein accession:  | AAH05292 | 
| Storage buffer:  | In ascites fluid | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunoprecipitation of CXCL11 transfected lysate using anti-CXCL11 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CXCL11 MaxPab rabbit polyclonal antibody. | 
| Applications:  | ELISA,IP | 
| Shipping condition:  | Dry Ice |