Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00006372-D01P |
Product name: | CXCL6 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CXCL6 protein. |
Gene id: | 6372 |
Gene name: | CXCL6 |
Gene alias: | CKA-3|GCP-2|GCP2|SCYB6 |
Gene description: | chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) |
Genbank accession: | NM_002993 |
Immunogen: | CXCL6 (NP_002984.1, 1 a.a. ~ 114 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
Protein accession: | NP_002984.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CXCL6 expression in transfected 293T cell line (H00006372-T02) by CXCL6 MaxPab polyclonal antibody. Lane 1: CXCL6 transfected lysate(11.90 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Effect of alginate encapsulation on the cellular transcriptome of human islets.Vaithilingam V, Quayum N, Joglekar MV, Jensen J, Hardikar AA, Oberholzer J, Guillemin GJ, Tuch BE. Biomaterials. 2011 Sep 1. [Epub ahead of print] |