CXCL6 polyclonal antibody (A01) View larger

CXCL6 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CXCL6 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CXCL6 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006372-A01
Product name: CXCL6 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CXCL6.
Gene id: 6372
Gene name: CXCL6
Gene alias: CKA-3|GCP-2|GCP2|SCYB6
Gene description: chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
Genbank accession: BC013744
Immunogen: CXCL6 (AAH13744, 38 a.a. ~ 114 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Protein accession: AAH13744
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006372-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.47 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CXCL6 polyclonal antibody (A01) now

Add to cart