| Brand: | Abnova |
| Reference: | H00006366-D01 |
| Product name: | CCL21 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CCL21 protein. |
| Gene id: | 6366 |
| Gene name: | CCL21 |
| Gene alias: | 6Ckine|CKb9|ECL|MGC34555|SCYA21|SLC|TCA4 |
| Gene description: | chemokine (C-C motif) ligand 21 |
| Genbank accession: | NM_002989 |
| Immunogen: | CCL21 (NP_002980.1, 1 a.a. ~ 134 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
| Protein accession: | NP_002980.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of CCL21 transfected lysate using anti-CCL21 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CCL21 MaxPab mouse polyclonal antibody (B01) (H00006366-B01). |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |