Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00006366-B01P |
Product name: | CCL21 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human CCL21 protein. |
Gene id: | 6366 |
Gene name: | CCL21 |
Gene alias: | 6Ckine|CKb9|ECL|MGC34555|SCYA21|SLC|TCA4 |
Gene description: | chemokine (C-C motif) ligand 21 |
Genbank accession: | NM_002989 |
Immunogen: | CCL21 (NP_002980.1, 1 a.a. ~ 134 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
Protein accession: | NP_002980.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CCL21 expression in transfected 293T cell line (H00006366-T01) by CCL21 MaxPab polyclonal antibody. Lane 1: CCL21 transfected lysate(14.74 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |